.
The Open Protein Structure Annotation Network
PDB Keyword
.

373903

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 373903
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS6681,16421009 Molecular Weight 24832.00 Da.
    Residues 229 Isoelectric Point 4.99
    Sequence mkklitandiraahargeqamsvvlrasiitpearevaellgftitecdesvpastsaqacksesqrir eaiiaqlpegqfteslvaqlmekvlkekqslelgtmqpsftsvtgkggvkvidgssvkfgrfdgaephc vgltdlvtaaagssmaagfmqwdnaffpwtlnydeidmvlegelhvrhegetmiakagdvmfipkgssi efgtptsvrflyvawpanwqsv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch