The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 373943
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS6685,NPUN_22DEC03_CONTIG1_REVISED_GENENPF6341 Molecular Weight 18049.65 Da.
    Residues 160 Isoelectric Point 4.74
    Sequence msdikklgsswiinwffgfnqiptnedssiymksvltcaaaagvispeekdwalgfcaswgvadwvied lktyeadealeeviarspqvsmaqrdillsaiwvsaadgelhekekakirkmatilgikeeivdqleql qqeeaalrqkrlnllypqkspy
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch