The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 373950
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS6688,NP_388303.1 Molecular Weight 15761.01 Da.
    Residues 140 Isoelectric Point 5.31
    Sequence mnqqdikqkvldvldhhkvgslatvqkgkphsrymtffhdgltiytptskethkaeeiennpnvhillg ydcegfgdayvevagkakinnsaelkdkiwssklerwfdgkddpnlvileiepedirlmnagaatpvsl el
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch