.
The Open Protein Structure Annotation Network
PDB Keyword
.

374010

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 374010
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS6705,NPUN_22DEC03_PLASMIDD_REVISED_GENEPNPDR040 Molecular Weight 9680.42 Da.
    Residues 82 Isoelectric Point 4.63
    Sequence mklthnlaaapsefawwieiitnhpnctyyfgpfispkeaywflpgyiedleqegnqeirfqilqcqpk eltisknewqdsa
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch