The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 374083
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS6713,CHUT_08NOV04_CONTIG199_REVISED_GENE212, PF01797, 91829 Molecular Weight 17324.16 Da.
    Residues 146 Isoelectric Point 8.77
    Sequence myiqivfavkgrnslihpswenelhkymtgfiqnngqkllaingmpdhihiligmkpscclsdlirelk kssssfikdkklspyafqwqegygafsyshsnlnqviayimnqkehhkkrtfkeeylefiqkfeleynp knlfewmd
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch