.
The Open Protein Structure Annotation Network
PDB Keyword
.

374152

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 374152
    Molecular Characteristics
    Source Arthrobacter sp. fb24
    Alias Ids TPS6720,YP_831391.1, _0105.000849_, _0115.002068_, PF07582, _0004.005091_ Molecular Weight 37509.05 Da.
    Residues 333 Isoelectric Point 5.03
    Sequence mprpytlftgqwadlpfeevarlasgwgydgleiavsgdhldawrwdepgyvqsklavlekynlkvwai snhlkgqavcddpidfrheaivgskvwgdgdpegvrtraaeemkhtarlakalgvdtvvgftgssiwqy vamfppvpekviqagyqdfadrwnpildvfdecgvrfahevhpseiaydywttvrtleaighreafgln wdpshfmwqgidpvsfiwdfkdriyhvdckdtklrptgrntvlgshlpwgdprrgwdfvsagrgdvpwe ssfraltaigydgpisvewedagmdrlhgapealaalkkfdfpasqtsfdaafsskd
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch