.
The Open Protein Structure Annotation Network
PDB Keyword
.

374924

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 374924
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS6801,NP_636789.1 Molecular Weight 55812.07 Da.
    Residues 517 Isoelectric Point 5.47
    Sequence mpglpppavepavtsikqedliqsvadalqyisyyhpvdyiknlsaayereespaakdaiaqilinsrm caeghrpicqdtgivtvfleigmnvrwddatmgvedmvnegvrraynhpdnklrasvladpagkrantk dntpavvstkivpgdhlevivaakgggseakskfamlnpsdsivdwvlktvptmgagwcppgmlgigig gtaekamllakealmepidivdlqargasnraeelrlelyekvnalgigaqglgglttvldikvkdypt haanlpvalipncaatrhahftldgsgpvmldppsledwpkltynptnarrvnldtitreevasfkpge vvllngklltgrdaahkrmidmlnrgetlpvdftnrfiyyvgpvdpvrdevvgpagpttatrmdkftrq mleqtgllgmvgksergdaaidairdnkavylmavggsaylvskaikaarvlafedlgmeaiyefevkd mpvtvavdstgesvhktgprlwqsrigkipvvve
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch