The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 375210
    Molecular Characteristics
    Source Deinococcus geothermalis dsm 11300
    Alias Ids TPS6841,DGEO_15APR04_CONTIG112_REVISED_GENE1948, 3.40.1190.20, 285243 Molecular Weight 32304.96 Da.
    Residues 310 Isoelectric Point 5.83
    Sequence vkffvigdvtvdhlyhldrlpapgeevaptratmkpggaggtisvtlarlghsvtlaarvgddpfaeya lasvresgvlqaaiqidpehltstitvmqtpdgqramisdgaanrqldpaklkkkdiegadalivsays ltegpqreytlkaietakkakkpvpvfidlgtgavnkvgtdlienvigadyltlnqhellaltdttsis aalaqlgdagarrvivkvgrmgsivwtptetelvdpikpegrvvdstgagdtftaafahavltghslpq aarignaagalaatrvgaqarpitladleaalar
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch