.
The Open Protein Structure Annotation Network
PDB Keyword
.

375214

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 375214
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS6843, Molecular Weight 29717.45 Da.
    Residues 272 Isoelectric Point 4.85
    Sequence mktsvkfetifplttapliqcitneitcesmanallyidakpimaddprefpqmfqqtsalvlnlghlsqereqsl laasdyarqvnkltvvdlvgygasdirnevgeklvhnqptvvkgnlsemrtfcqlvshgrgvdgspldqseeaie eliqalrqqtqkfpqtvflatgiqdvlvsqeqvivlqngvpeldcftgtgdlvgalvaallgegnapmtaavaav syfnlcgekaktksqgladfrqntlnqlsllmkekdwfeavkgrvl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals


     

     

     

     

    Protein Summary

    375214 is a puataive hydroxyethylthiazole kinase from Enterococcus faecalis V583. It shares significant sequence homology to hydroxyethylthiazole kinase protein from pyrococcus horikoshii OT3 (PDB 1v8a) and 4-methyl-5-beta-hydroxyethylthiazole kinase from bacillus subtilis (PDB 1c3q etc), and other TIM-fold enzymes as detected by FFAS (link) . The structure of 37514 is similar to  4-methyl-5-beta-hydroxyethylthiazole kinase  with rmsd of 1.53 A for 234 aligned Ca atoms (sequence idenitity 29%). The active site between these two enzymes are nearly identical, suggesting a conserved function. The asymmetric unit contains two monomers, the biological relevant trimers are generated by crystallographic symmetry (Figure 1).
     

    A member of HK family (PF02110).

    Figure 1: Trimer, ADP are shown in sticks.

    trimer.png

     

    Campobasso, N.,  Mathews, I.I.,  Begley, T.P.,  Ealick, S.E. (2000) Crystal structure of 4-methyl-5-beta-hydroxyethylthiazole kinase from Bacillus subtilis at 1.5 A resolution. Biochemistry 39: 7868-7877

    Ligand Summary

    Each promoter contains a ADP.

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     trimer.png
    Trimer generated by crystallographic symmetry.
    196.34 kB00:19, 10 Jul 2008qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch