.
The Open Protein Structure Annotation Network
PDB Keyword
.

375903

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 375903
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS6886,NP_388267.1 Molecular Weight 33543.22 Da.
    Residues 292 Isoelectric Point 6.21
    Sequence mldkktdillaarklfsekdftsvsmqaiaeeckmskasiyklfqskedlllellsfnqkqmvaaasrl qentaltpeerltqkvkmelegfrrnqqffnmltygnprlhndrvkqhihqtrstiicwhrdsliqayg etilpfvwdlviilhgmmreflmlikieekpleldpiaefiistlnqiiknretrqsllppeaielyih sassykpkdksvllseslkelhkgisslsaadydvdeltsaaamleeeakkeeprafllksligyleqt gvltqpvsmlktllit
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch