.
The Open Protein Structure Annotation Network
PDB Keyword
.

376144

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 376144
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v/r
    Alias Ids TPS6905,NP_687854.1, _0077.002005_, 104157 Molecular Weight 26648.92 Da.
    Residues 226 Isoelectric Point 5.47
    Sequence mlkdkmiakgakyiqsiyqdpfiqgiikgrldhdvichylqadniylgkfadiyalclaksdnlrdkqf fleqidftlnreladgegphqalaaytnrsyqdiiekgvwypsadhyikhmyfhfyengiagalaamsp cpwiyhqlakkiieenqflngnpfnnwitfyandtveelmenyfrmmdyyaqnlskekqadlvdafvks cqherrffqmainqekwed
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch