The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 376525
    Molecular Characteristics
    Source Acidothermus cellulolyticus 11b
    Alias Ids TPS6950, Molecular Weight 12831.74 Da.
    Residues 113 Isoelectric Point 4.29
    Sequence mvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgiplterttayggvlpdriiiyrntic alcetesevidevrktvvheiahhfgidderlhelgy
      BLAST   FFAS
    Ligand Information

    Protein Summary

    This sequence matches Pfam DUF1025.  The family DUF1025 contains a distinctive HEXXH motif, which is usually distinctive to metallopeptidases.  In the case of these peptidases, the conserved histidines are usually involved in co-ordinating Zn ions.  DUF1025 appears to be related to UPF00054 and Peptidase_M48.  In addition, borderline hits, no included in Pfam show that this sequence may also be related to the Matrixin family. 

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch