.
The Open Protein Structure Annotation Network
PDB Keyword
.

377419

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 377419
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS6978,NP_282470.1, 92138 Molecular Weight 43625.81 Da.
    Residues 373 Isoelectric Point 7.88
    Sequence miycdhcvmpntrpginftkdkegknicsacinhknkenidykarfkelevlcdkyrrmngkfeydcai avsggkdshfqvhimkeklgmnpilfsvednftmteagkknlknlsetfgchiislkpdiktqkkvmlk tfekygkptwfidrliysypfamalkfntpllvygenvsyeyggsdteetpsakeiflngvasdlnine fiddeikeenlqlffnpnkdkldklnpiylsyfvkwnsysnyifaksrgftdlegewdrtmcaenfdqv dsigyilhawmkypkfghacasdyaarfvrygllsrkeaielvqkrdhkldnkcvedfcnfigiskttf wkivekhynmdlfykndfgefklknklq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch