The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 377686
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS6995,YP_553892.1, 335723 Molecular Weight 28619.83 Da.
    Residues 264 Isoelectric Point 5.48
    Sequence msvgrigfigtgsiteaivtglatcadvptevwlsprnaqiadrlaqaypmvqvagenqevvdrcdvvc lavrpqvaesvlqalrfsgrhhvisfiatygldklrtliapaktlvraaplptvaehlcntlvfpaddi arslftqlggaievgseeafdvlfsatatmgsyfallhnqarwleqhgstyseardylaslhfglasva rktqtrfdelskefttagglneqvldalgahrvfnafddafdqvlhriggtvsqrne
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch