.
The Open Protein Structure Annotation Network
PDB Keyword
.

377801

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 377801
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS7003,SSUI_28JUL04_CONTIG224_REVISED_GENE781, 104667 Molecular Weight 27696.16 Da.
    Residues 236 Isoelectric Point 8.30
    Sequence mkvpkyqliqndlrqqivsgkfengdkfyteseltklfnvssitviravnelvkdgylvrqqgkgtfvs rsrkgrlvefsdieifpmdkdkvtvlscekgnkpdileklnldknefyykivrvraaedtpyifhnsyi pqryiqnpdaplehyqsiyqrfkldynihmseepfvetneivspcpkevathlklkatepavlqnkttt nstsgevmeytetykhwkyykfeitanhr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch