The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 377907
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS7016,YP_927208.1, 92019 Molecular Weight 21626.61 Da.
    Residues 193 Isoelectric Point 5.57
    Sequence mslladpnayfsvthdfnaylqpfdgpmpsdaellgmrsvglqllsdvktleagcllhlrqldneakav vdflklqsrkvdmvlhyvleneqrdgkryrgvsfggsniviesqgtlrpgelykttvyirdelialvci arvtsvsheegreltelvyegileadvehlvkaslsvqqkqlkarkqqapspler
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch