The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 378118
    Molecular Characteristics
    Source Arthrobacter sp. fb24
    Alias Ids TPS7045,ARTH_26JUL04_CONTIG17_REVISED_GENE194 Molecular Weight 16313.64 Da.
    Residues 147 Isoelectric Point 6.16
    Sequence mvkqpvsvngvvrwkdvgladqakseqkerkmvvlrheigdvlrdvrqrqgrtlrevshsarvslgyls evergqkeassellssicsaldvplssmlrevsdrvavaegvavpdtvpqefsqryldrelntelsdel akgllsgar
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch