The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378443
    Molecular Characteristics
    Source Methanococcus maripaludis s2
    Alias Ids TPS7102,NP_988750.1, _0000.000321_, BV1071, _0000.000765_ Molecular Weight 61491.24 Da.
    Residues 549 Isoelectric Point 5.69
    Sequence mavtvenltkrygekvaldnvsfdvkkgdilgiigksgagkttlikilrgvesfdegkievcgktenlr eitaihlqrnfalwaepaiyniirklyavrtdsdeglpleeemeeyrkdateilklvglehkkdaysni lsggekqrlilgrqlakiyakngdgvllldepatmacpaskqilldvlknineklgvtiivtshlpeih kylcksciliengkiimkdtpekvvdeflkdmveaydrlskptdktvvevedaskryyvvnggetlnlk disfkvkekeilsilgpsgtgksvilrllagleapdkgvvklegidlkdfgwnrmnlrrkigimhqefs lahyltvnellkyrlgvksietvesaklkaaelgispkmvdglyqlldlpetemrnkldkigisemvvr klfpakpveydanellealdlnketlnkkptelsggekvrvamalqlalepdillldepfgdldpltlr evsnylkkindtvgttiilishhvelikeisdrailidegkllmngnpeeicekfiersnskfmnq
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch