The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378904
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS7126,NP_717546.1, _0000.000963_, 87042 Molecular Weight 17032.60 Da.
    Residues 149 Isoelectric Point 7.74
    Sequence mtqklaiimrglpgsgkshwveqfianltledalrlrqggifstdsffyqgeeycfdakklseyhqrnl tafiqalsnaqpivicdntnlsrweymayeaaakaldyqvrivlvgdpsdsvhqklcaernrhgvpltq irrmaklfeaf
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch