.
The Open Protein Structure Annotation Network
PDB Keyword
.

379250

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 379250
    Molecular Characteristics
    Source Desulfovibrio desulfuricans g20
    Alias Ids TPS7166,YP_390167.1, 292032 Molecular Weight 30685.30 Da.
    Residues 282 Isoelectric Point 5.73
    Sequence mnavlqkkggvgiiilarldstrlpgkalrtaagkemlgyvverarmvrgvseivlattdrtvddrlee yaaacdlavfrgsdvdvagrvaacvrwrgwdafvringdspfidpqtissavnllyglggvsaaglsds haqrgnmhaecaslplvacgsvtlagyaghdatelpdmvtnvlrrtfpkgqsvevcrasaflagyaamh lpehlehvtkyfydtrsirimnmesgdpslgeiqlavdteedfalfermlarmdrphtayaaheiiely reclhg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch