The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 381752
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS25231,YP_545107.1, BIG_447, BIG_71, 86574 Molecular Weight 16392.61 Da.
    Residues 145 Isoelectric Point 5.18
    Sequence malfhpsrdqvrqfffdawakfqqqqaltdletiavdiiqahpeyhhvleapeqyleqsyfpemgetnp flhmslhlsvleqvsidqppgihaayhalarkygsvieaqhalmdclaeaiwqaqrsstgldaqayaac ieakarg
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch