The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 381942
    Molecular Characteristics
    Source Chloroflexus aurantiacus j-10-fl
    Alias Ids TPS7346,CAUR_25MAY01_CONTIG1092_REVISED_GENE1551, BIG_308, 283279 Molecular Weight 59958.59 Da.
    Residues 528 Isoelectric Point 5.93
    Sequence lakrknhaqaiettganlgfepqlwqtanalrgsmdaaeykhvvlgliflkyisdafeehrerlqnipn adpedpdeyradnvfwvppdarwvelrnnarqpnigelidqamiaverdnpslkgvlpkdyarpaldqq rlgqlidlvsnipvgtasarskdvlgrvyeyflsqfasaegkkggefytprcvvrllvemlepyqgrvy dpccgsagmfiqsvefieahatgngngsrararisiygqelnyttwrlakmnlairgidgrieqgdtfr ndrfpdlkadyilanppfnmkewggeqlrndkrwqygippvgnanfawvqhivhhlapagvagfvlang smssnqsgegeirrklieadlvdcmvalpgqlfystqipaclwflarnrnngkfrdrrkqilfidarrl grmvdrihreltdeeieriactyhawrgesdageyrdipgfcksasledvrkhgyvltpgryvgsevre dddepfaekmqwlvaqlreqqaeaakldeaivanlqelgfweqkr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch