.
The Open Protein Structure Annotation Network
PDB Keyword
.

382180

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 382180
    Molecular Characteristics
    Source Synechococcus elongatus pcc 7942
    Alias Ids TPS7353,YP_399065.1, 3.40.640.10, BIG_554, 88668 Molecular Weight 50713.57 Da.
    Residues 447 Isoelectric Point 4.78
    Sequence msslssealeriraqfdygpyprvpleatpkenygalaihdirsafyrrdrslkategacildvgcgsg yktlmlalanpgaeiigvdlslksvelaqerlkfqgfpevkfyalgldeigqleiafdyincdellyff ddpaaalgqmkavlkpdgiiranlhsknqriahyrlqelfkflgfldgnpeaaemeavtelmnalqpgv lsraavwnlplqlqkeekqdeleqwllanlllqadkgygvpdlrqyletagleflgmvqaplwrlself gdrdqipafwalgiqeaslldqaylydllhpvnrlfdfwcslqplaptqawenlpleqrlglkvqlhpq latsgieqqlqeklklrerfslaralhgeflglltyeplfgalikplfekvlsvqelvqrfqqlqpldy vtgelweleavaelvwnflaelerdqclfltqa
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch