.
The Open Protein Structure Annotation Network
PDB Keyword
.

383123

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 383123
    Molecular Characteristics
    Source Silicibacter sp. tm1040
    Alias Ids TPS7394,ROSE_TM1040_30MAR04_CONTIG56_REVISED_GENE3336 Molecular Weight 31153.80 Da.
    Residues 283 Isoelectric Point 6.76
    Sequence mratlaaaardlnaaarfgadtacregyhpvmlntiihgtptdqpplliahglygsgrnwgviakrlad erqviavdmrnhglspktqshsyvdlaedlaeviaahggrmdvvghsmggkaammlalrhpeavnrlvv adiapvsyqhtqahfitamrsvdlarvtrrsdaqeqlaaagvdamlqsfftqsldvenkswrlnldtle remphilsfpevethwdgtalfltgahsdyvlpehrpqikrlfpaarfakipgaghwlhaekprefeat vrgflna
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch