.
The Open Protein Structure Annotation Network
PDB Keyword
.

383464

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 383464
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS7419, Molecular Weight 25311.26 Da.
    Residues 224 Isoelectric Point 5.52
    Sequence mlieipnvfskqevshlreqldarrwidgnqtsgamattrkrnqqldkddpvavalgqqimdrllahpqfvsaalp lqfypplfnryqggetfgyhidnairstpdgmirtdlsatlflsepenyqggelviqdtygqqsiklsagslvly pssslhqvtpvlsgertaafmwlqsmvrdegqrrllfqldqsiqsltaqtaaeqelfnlsgvyhnllrrwsel
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

    This protein is annotated a member of the 2OG-Fe(II) oxygenase superfamily (PF03171) from Pfam (E-value: 1e-08).  This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily. The protein, however, has Ni ion bound to it, which could have replaced Fe during the purification process.


    Fig 1. Monomer structure with Ni ion (red sphere).

    The protein assembles as a trimer in the crystallographic asymmetric unit. This could also be the relevant biological unit.

    This protein is strucutrally similar to a factor Inhibiting Hif-1 alpha (PDB code: 1h2m) and prolyl-4 hydroxylase type I (PDB code: 2jig). Both of these proteins have a metal ion bound at the same location as Ni.
       
                          A                                                               B
    Fig 2. A. Superposition of 1h2m (cyan) and 2jig (yellow) on the protein (green). The metal ions are shown as spheres. B. Active site view showing Ni interacting with His (96, 157), Asp (98) and two imidazole molecules.

    Ligand Summary

    Ni ion

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch