The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 386994
    Molecular Characteristics
    Source Mesorhizobium loti
    Alias Ids TPS7473, Molecular Weight 32971.98 Da.
    Residues 300 Isoelectric Point 5.76
    Sequence mmtdearaklaaipmlagytgplerlggltnlvfragdlclripgkgteeyinraneavaareaakagvspevlhv dpatgvmvtryiagaqtmspekfktrpgsparageafrklhgsgavfpfrfelfamiddylkvlstknvtlpagy hdvvreaggvrsalaahplplaachcdplcenfldtgermwivdweysgmndplwdlgdlsvegkfnanqdeelm rayfggearpaergrvviykamcdllwtlwgliqlandnpvddfrayadgrfarckalmetpefsrhlaavrmg
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Member of the CAK family of protein kinase-like kinases (PKLs), with all catalytic motifs intact, though some are highly divergent: for instance, the HxDxxxxN motif reads HCDPLCEN. It has one or possibly two very similar homologs in Phaeobacter gallaeciensis (both alphaproteobacteria, but different orders), and is more weakly similar to the MarR subfamily of CAKs, in which the CAK is typically fused to a MarR transcriptional regulatory domain, which usually responds to external cues. This gene does not have any other domains. The GOS metagenomic dataset also contains over a dozen reads of very similar kinases, of which most include the unusual HCDPLCEN motif (176-183 in 386994). 386994 is similar to other CAKs (e.g. rmsd 3.0A for 255 aligned CA with 2ig7, 19% seq id).

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    386994 surface with HCDPLCEN motif region highlighted
    134.53 kB23:22, 15 Jul 2008qxuActions
    monomer of 386994
    111.41 kB23:04, 15 Jul 2008qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch