.
The Open Protein Structure Annotation Network
PDB Keyword
.

387013

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 387013
    Molecular Characteristics
    Source Pseudomonas aeruginosa pao1
    Alias Ids TPS7475,NP_250520.1, 91953 Molecular Weight 40831.35 Da.
    Residues 356 Isoelectric Point 5.65
    Sequence msltdqstrirageeldaavidpylkahipglegtpkisqfpggasnltylieyprqefvlrrppfghk aksahdmgreyrilnqlnagfpycpkaylyctdesvigaefyvmervkgiilraelppelnldeqqtrs lcksfidkfvelhnvdyaacgladlgrpdgyvqrqiagwtdryekaltpdaplwepvkawlkdkqpadh hkpgivhndyrfdnvildpenpmqiigvldwelatlgdplmdlgntlaywveagdpapvqltrrqpshl pgmltrrefadyyaeragippidnldfyytyglfrlagivqqiyyryyhgqtqdkrfaqfvqmnklleq mslqaiersrl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals



    Protein Summary

    Member of the CAK family of protein kinase like (PKL) kinases that share a fold and catalytic mechanism with eukaryotic protein kinases. Related to the ACAD-like family with a HNDYRFDN in the catalytic loop and a DWE in place of the DFG motif. Appears to be catalytically active.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch