.
The Open Protein Structure Annotation Network
PDB Keyword
.

388571

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 388571
    Molecular Characteristics
    Source Eubacterium rectale
    Alias Ids TPS7530,RER070207002971, RER070207002971, 285576 Molecular Weight 37291.46 Da.
    Residues 322 Isoelectric Point 6.04
    Sequence lynqpevalekyeltvsriikgrgayicdtgigqkllvpyrgheqractlrdtlafiqrngmdveqisq tkeqciisrdncedayilkdyragrecstdsiddmrggsralaqlhnilekyplpsdieveslyekaqr kcaqivklknyilrrsktnafehlfyecyerfleqgqksaeilcelensktsvpiychgafnqhnvvyt qsgrwlpvnfetmhpgypetdlaeymrkmleknhwdtavadaildsycsvrslddtsmrllqalllfpe kfcklcnhysnsrkswvcdrdvdklaqliqlsgereeylhalqaiv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch