The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 388636
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS7535,YP_002936175.1 Molecular Weight 25965.56 Da.
    Residues 224 Isoelectric Point 4.70
    Sequence mtktsdfddkvnysgdykgnysgdyrdnyssdysatgyarlakslidivkeqqaklgyrkeivrlyypl stlrhffecagadnkiatgmiseqqmleilapnnlpkqltdtigeikvtaknerfcieippegseyvhe ntadnefiselialvgthgctmeqitelfykysdniekkdmqngefdcyirflnepddtyyycfhdegc hiiyhrflpqdyadfgf
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch