.
The Open Protein Structure Annotation Network
PDB Keyword
.

388668

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 388668
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS7545,YP_002938796.1, 60680885, 87791 Molecular Weight 49657.20 Da.
    Residues 437 Isoelectric Point 4.47
    Sequence makigivicnynkqndvidciqsvleskyedyhiyvvdnastdesvrlirecygscdrltliensenlg gsggfntglrvamaeghmylmcvdndalldencigtlsdfldshekagiaaakiyhtgqenyvqqygsf idydnysvdstylnhiedgsmpdvvysdavpacalmirrtvveqigvmpeenflywddtewcvrcreag yevasvgaaaashamgakkedintfptyyawrnwikffldhideerlsdmaetflgsifeinytdlyrg eenrsktvmaalddalhkvmgkakedrifnleltydgleraigdksdiaimagefplyadalkekikvm wpdkrvyivglqdideaygtahfqpdatiticesifrqddlslstyvmdldgnvlvdeddvlmvinynf srrsfifsmkplfmrlsrqnygf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch