The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 388715
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS7549,NP_815879.1, _0052.000186_, _0083.002215_, 291081 Molecular Weight 57877.46 Da.
    Residues 493 Isoelectric Point 5.03
    Sequence myrvmfvddeymileglkwiipwqelgfeivktarsaqealafletesidvlltditmpemsgielieq akkkghqfislilsgyqefdyvkkgmalqvqdyllkpvnkqellaniqrikieldqqkksharvrlyle nglmrwlndeisegeyeelmqqfatikpgdftvllveaemsfletikelfmkkgqllfieswmstyhql lliykgarqeaflfireieailagqgqifvgesvnewetvyesyekvkqlqaietfyqeflpnnqkeqm nrsaedftflafnqalmigdmqtiqreldaifnqlsqqhatpeyvryvvfllfsdisrqyptvleenye kiveeirasnnlntlyalmqqvlaevknkpkikkysesvsqaverieqgyleelnlktvadelhlnpsy lgqifkketkrsfsqylnqvrtkhaqklllytddtineisekvgfnntnyfskmfkklngitpkefreq yqsnyagvee
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch