The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 388828
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS7559,YP_546064.1, PF03963, 85810 Molecular Weight 23653.05 Da.
    Residues 228 Isoelectric Point 4.35
    Sequence mtstpgisdsllssmngsgannntsaisetqdrfmklliaqmknqdplnpmdnaevtsqmaqlstvtgi ekmnaslstfissmqatqalqassligntvlvegnstylapaetegesaaylgvelpigadkltvnikn gagnvvktitvtnqpagisslgwngygddgtklpdgrytieatattgnssvastplsyeqvmsvstgsd gvklnlsnlaaittdqikqif
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch