.
The Open Protein Structure Annotation Network
PDB Keyword
.

389303

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 389303
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS7600,YP_001298650.1, _0110.001926_, _0024.003231_, _0030.001769_, _0030.000170_, _0109.003022_, 335572 Molecular Weight 20156.00 Da.
    Residues 169 Isoelectric Point 5.41
    Sequence mreisfrndilplkdklyrlalritlnsaeaedvvqdtmirvwnkrdewpqfesieaycltiarnlaid rsqkmeaqnlqltsevrempdtltpydrlaqneqiqlvhrlvnelperqrttmqlrdvegksykeiadi lqiteeqvkvtlfrarqkikqryteiedygl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch