.
The Open Protein Structure Annotation Network
PDB Keyword
.

389673

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 389673
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS7618,NP_390127.1, BIG_326, _0018.001305_, _0005.000994_, BIG_364, _0055.004099_, _0085.000952_, _0061.000710_, 85487 Molecular Weight 41976.20 Da.
    Residues 377 Isoelectric Point 6.16
    Sequence mrklkigitcypsvggsgiiatelgkqlaekgheihfitssipfrlntyhpnihfhevevnqyavfkyp pydltlaskiaevaerenldiihahyalphavcaylakqmlkrnigivttlhgtditvlgydpslkdli rfaiessdrvtavssalaaetydlikpekkietiynfidervylkkntaaikekhgilpdekvvihvsn frkvkrvqdvirvfrniagktkaklllvgdgpekstacelirkygledqvlmlgnqdrvedlysisdlk lllsekesfglvlleamacgvpcigtniggipeviknnvsgflvdvgdvtaataramsiledeqlsnrf tkaaiemlenefsskkivsqyeqiyadlaepe
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch