.
The Open Protein Structure Annotation Network
PDB Keyword
.

389700

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 389700
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS7619,17741232 Molecular Weight 44870.92 Da.
    Residues 416 Isoelectric Point 5.65
    Sequence mnspadydpkprrasvavdvggvivgggapvvvqsmtntdtadidatvrqvaalfqagsemvritvdrd esaaavpkirerllrlgmdvpligdfhyighklladhpacaealakyrinpgnvgfkdkkdkqfgeive mairydkpvrigvnwgsldqellttlmdrnkeqgfplsarqvtreaivqsalisaelaeeiglprnrii lsakvsqvqdliavysmlsersnhalhlglteagmgskgivassaamgyvlqhgigdtirvsltpepng drtrevqvaqellqvmgfrqfipvvaacpgcgrttstvfqelaqniqndirknmpiwrekypgvealnv avmgcivngpgeskhadigislpgtgespaapvfidgekaltlrgpniaadfealvidyiekrfgqkdaae
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch