.
The Open Protein Structure Annotation Network
PDB Keyword
.

390017

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 390017
    Molecular Characteristics
    Source Eubacterium rectale
    Alias Ids TPS63471,RER070207000695 Molecular Weight 24669.18 Da.
    Residues 224 Isoelectric Point 4.80
    Sequence kdyktfpdkytlssvdvggmtakeakkaikkaidkyqikvklddaefemnaedlgleynekadmqtlin aanrnkvpdkqvklfnmkkgdemqnalvdsyitamteaqtdstsntdndtddtkqadksdaeifdiktv vpyratitynadagqfegvdgvsgdapiydkaatklssavkemkkkaelesstgyvegekaadsdavkk alkeadayldvtvqrhl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch