The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390070
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS7667,NP_721134.1, 87538 Molecular Weight 11963.05 Da.
    Residues 107 Isoelectric Point 9.50
    Sequence sstgektsqsseetkvrlivktdsnktdekvafkkgatvmdvlkdnykvkesggfittidgvtqdkkag rywmfdvndklaskaadkikvkngdkiefylkvykgkn
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch