.
The Open Protein Structure Annotation Network
PDB Keyword
.

390168

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390168
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS7683,YP_210872.1, 88019 Molecular Weight 55935.73 Da.
    Residues 489 Isoelectric Point 4.92
    Sequence ascnkfddlntnpdaatkvtapmlatklilnitqqgsaknfvyhsmlskqiawsenasdeqynlfgrtd fdgytiltncqkmvdaanegdkdsyaalakfmkayklfykslevgdipysdalkgeegvqkpkydtqke vmrqvledleeaytlfssgsdfdgdpifggdtenwkktvvafelkvlthlckkdtdadlkvkerfarlv ssgslmtsnadnfqlvysnkagqlypfyytqnkhsdylmmssviidnlkkfndyrmfyyaspakaqtdk gikdsewdaylsidpsdsysnisvlygkgefclanlrytrvpegeplmrlsyaeqnfilaegavrgwis edastyykkgieasmnfiadntpdkeeythgrtitqeyiqeylaqpviqlsgdkekdlemillqrylas flqhpydayydyrrtgypvlpinpstnlnteknkiptrwmypeaefsynpdnaneavqrqyngsddvnklmwilq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch