The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 390213
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS7698,YP_001299250.1, 88205 Molecular Weight 30222.03 Da.
    Residues 262 Isoelectric Point 4.34
    Sequence nsdvpenthlvskevqaafnakypqakdvewelkgdyavadfywdggehsawfnplsaawymtetdvry enlpepvlaahkagkyadwrvddvdkltregmetlyvievekgeseldlfysstgilvktvvdtgheed yddylpqpdangiiaivkqkypnativeierekglqevtildenkekevyfnernewmgtswdvqvanl peavkksvmekysdyviddadyvvtpdnewyildlenkqidkelkvkvdkdgvwl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch