The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 390654
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS14593,BFUN_06OCT04_CONTIG482_REVISED_GENE5922, 3.40.640.10, 289451 Molecular Weight 43996.56 Da.
    Residues 405 Isoelectric Point 5.75
    Sequence vnplldslqpypfeklralfkdvtpnaglahisfgigepkhptpalirdavvaslgglsaypatsgspa lresiakwvtqrynlppvdpatqvlpvsgsrealfslaqtvldpqknaggepaivlcpnpfyqiyegaa ilagaqpyfvnsdparnfacdysavpaeiwartqllyvcspgnptgavltlddwrelfalsdrygfvia sdecyseiyfdeakpplggleaahklgrgferlvmlsslskrsnvpgmrsgfvagdaailkdfllyrty hgaalstvfqnasiaawndeahvrenrakylqkfstvtpmlaevldvrlpdaafylwadvsrtgltdtv faqrlyadynvtvlpgsflartahgvnpgrnfvrmalvadvdectqgaqrivdfcralag
      BLAST   FFAS
    Ligand Information

    Protein Summary

    PFAM Annotation: Pfam Aminotran_1_2 family

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch