.
The Open Protein Structure Annotation Network
PDB Keyword
.

390706

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390706
    Molecular Characteristics
    Source Caulobacter crescentus cb15
    Alias Ids TPS14601,NP_419263.1, 3.40.50.10490, 429739 Molecular Weight 37298.29 Da.
    Residues 363 Isoelectric Point 5.60
    Sequence meatvltrhetpaptgasppslapasthmfreageaarvaavqltanapkiqalaqrlranpprvvvtc argssdhaatfarylietkagvltssagpsvssvydaspnlegalylaisqsgkspdllaavkaakaag ahavalvnvvdsplaaladeviplhagpelsvaatksyiaalvavtqliaawtedaeltaalqdlptal aaawtldwslaverlktasnlyvlgrgvgfgvaleaalkfketcglhaeafsaaevlhgpmalvkdgfp alvfaqndesrasvdemaaglrargasvliaggggdapdalptlashpvlepilmiqsfyrmanalsva rgydpdspphlnkvteti
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch