.
The Open Protein Structure Annotation Network
PDB Keyword
.

390764

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390764
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb-2
    Alias Ids TPS14621,DHAF_12NOV03_CONTIG1073_REVISED_GENE2328, 2.60.120.10, 85562 Molecular Weight 17344.85 Da.
    Residues 154 Isoelectric Point 5.34
    Sequence mkrilnidnmprehiddpdfqskmqtllignalgcekiyvnidyvkpggksvkyhshskqeefflimqg sgllrmngeevsiktgdviskpagqeiahqfinngseilqildagtrekddiatypdenvvfirnkglv fdikdcmkgwtsdpns
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch