.
The Open Protein Structure Annotation Network
PDB Keyword
.

390770

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390770
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb-2
    Alias Ids TPS18247,DHAF_12NOV03_CONTIG1084_REVISED_GENE3186, 2.60.120.10, 85747 Molecular Weight 26411.28 Da.
    Residues 230 Isoelectric Point 7.29
    Sequence vndgsndfellgspwicenphanwtapaahgmfkrfkkkeiiihsgdqidyiyylhkgriktvaqspsg sqkilwyieagsifgetpffnrkpcdynffavtdceiyiypmevimqeiipkfpdltlsiiktlsrkvh ilstqvedcvfnkplvrvakliyllhqgriledkrgsssipltqediantlgmhrvtvnqalkhlkeiq alkehthliiihdpeklkevmea
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch