.
The Open Protein Structure Annotation Network
PDB Keyword
.

390981

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390981
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS20188,NP_106062.1, 3.10.450.50, 85254 Molecular Weight 13677.86 Da.
    Residues 124 Isoelectric Point 6.58
    Sequence medkmltktqvvdgaaikkaiesrdgkmlssfyaddalvrvidrnnppskprevrgraaiaifwddics ramthkvdttiadgdslaftqacaypdgtkvfaaamlelkngriarqtvvqawde
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch