.
The Open Protein Structure Annotation Network
PDB Keyword
.

391080

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 391080
    Molecular Characteristics
    Source Nitrosospira multiformis atcc 25196
    Alias Ids TPS24799,YP_412877.1, 3.40.640.10, 85580 Molecular Weight 42068.96 Da.
    Residues 392 Isoelectric Point 5.13
    Sequence mnicdlapayiraispyqpgkpiselaremgmdeqsiiklasnenplgtspmalnamskaldevslypd gsgfelkaalserygvtsdqivlgngsndvlelaarvflkpgastvysqhafavyplvtkavggigisv parnyghdldamldavapetrvvfianpnnptgtllpaddvlrflervspdvlvvldeayneylppalk gdsiawlkqfpnllitrtfskaygmagvrvgfglghpdvaglmnrvrqpfnvnniglagavaalqdeef vkrsyalnqagmlqivtglrqmgieyipsygnflsfrvpgnvkainesllkqgvivrpisiyempehlr vtvglesenekflkslaialettegaaadtipemavsfpkvasggta
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch