.
The Open Protein Structure Annotation Network
PDB Keyword
.

391446

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 391446
    Molecular Characteristics
    Source Silicibacter pomeroyi dss-3
    Alias Ids TPS24318,YP_165605.1, 3.30.70.900, 323946 Molecular Weight 10105.94 Da.
    Residues 89 Isoelectric Point 5.78
    Sequence mathalwqadvadfdawlkvfredramrkaagirdlhiwrdpdradhavalfeitnlasaqaffdseel amhherggiahitvklltpv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch