.
The Open Protein Structure Annotation Network
PDB Keyword
.

391468

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 391468
    Molecular Characteristics
    Source Shewanella putrefaciens cn-32
    Alias Ids TPS24322,YP_001181938.1, 3.40.640.10, 323981 Molecular Weight 41410.16 Da.
    Residues 373 Isoelectric Point 6.05
    Sequence mfsdfkkdfclanpgyllshsvgrplksteqvfkeaffapwqdsgrepwgqwlsviddftfalsklfng hqkdfcpqvnlssalakilmslarlnrehavvlmseidfpsmgfaikkalpascevrfipktlditdan vwdahmgsdidlvfvshaysntgqqaplanilamarqygclsvvdvaqsagiiplnlaqlqpdfligss vkwlcsgpgaaylwvnpsiidscqpkdvgwfshenpfefnihdfryhnsalrfwggtpsiapyaiaahs ihyfadigveqlrkgnqllidivaealdqefvspreiekrsgtlvlqfgeqqgqimaalakanisvdar smgirisphiyndkadiqlllsvikahr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch