.
The Open Protein Structure Annotation Network
PDB Keyword
.

391647

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 391647
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS14643,YP_001089028.1, 3.40.640.10, 91484 Molecular Weight 62013.65 Da.
    Residues 542 Isoelectric Point 5.81
    Sequence mknhtykeikniygkispfefkdklidiakytakennrelldagrgnpnwtcstareafftfghfaite trsnwdlghlagmpqkkgikerffkfinenidmpgaylardiinfginelgfdgdefvheladgiigdn yplpdrmlphmekivhdylvqemkydisgkygdveifavegataamcyifdslmanellkkgdtialmt piftpyleipnlprydfkvvninanevdekgahtwqytkkeleklrdksikalfvvnpnnpasiamdet scnnlidvienynkdlmiisddvygtfvedfsslmsklpyntvgvysyskyfgvtgwrlgtfalhkknv fdkkindltgelkksvdkrysdmslnpsslsfmervvadsrlvalnhtaglstpqqvqmaffsafalid kvdaykklnmsichrrqkllfealelpinenknnaayytqfdieewaklnygedlfkfisktaspvdvl yklandysvvllsgngfygpewsirislanlydeaytkigkaireilngyivewqkikk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch