The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 391673
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS14653,YP_001087104.1 Molecular Weight 25293.70 Da.
    Residues 225 Isoelectric Point 5.56
    Sequence misqneidilthslpfwdkltdlqkellissantshykkgnpvhcgdsdcigiliiksgtvrtyilsde grevtlfrlddgdvcilsascilktitfdvyvdaetdcdiiqisssvfaklstenihaelfsyklater fsdvmwamqqilfmsfdkrlasflideiakngsstinmtheqiakymgsarevvsrmlkyfaregivsl srggikvldkdklrsltl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch