The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 392003
    Molecular Characteristics
    Source Corynebacterium diphtheriae nctc 13129
    Alias Ids TPS24419,NP_938719.1, _0105.001783_, 323579 Molecular Weight 32419.41 Da.
    Residues 299 Isoelectric Point 4.90
    Sequence mnttplvigayaalpatradqetfydrlhadleatglelpfrdsihddpawlasqlagrftdsiitaip gtmmrvwdggtfglaspdddgrnaaiaftrsiidsaralddaaghrviagihihsapsvtanrdqflrs ltellegmdnddprliiehcdryneavtgekrflsieqeiaiaketgigitvnwgrsameaydtqlpar hiqalvaegvfegvmfsgagdkentfgaawadlhlphhvdepaslmdddriaeclsaaggaqkyhgaki qapadvdvatrvtmlghitrhlr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch